RhoV Antibody

  • Contact Vendor

Target Rhov
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym ARHV, CDC42-like GTPase 2, CHP, GTP-binding protein-like 2, ras homolog gene family, member V, rho-related GTP-binding protein RhoV, Rho GTPase-like protein ARHV, Wnt-1 regulated Cdc42 homolog 2, Wnt-1 responsive Cdc42 homolog 2, WRCH1-related GTPase, WRCH-2, WRCH2Chp
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases ARHV, CHP, WRCH2
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TQADLRDDVNVLIQLDQGGREGPVPQPQAQGLAEKIRACCYLECS