RHOXF2 Antibody

  • Contact Vendor

Target RHOXF2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym CT107, Paired-like homeobox protein PEPP-2, PEPP subfamily gene 2, PEPP-2, PEPP2cancer/testis antigen 107, rhox homeobox family member 2, Rhox homeobox family, member 2, Testis homeobox gene 1, THG1homeobox protein from AL590526
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases CT107, PEPP-2, PEPP2, THG1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQ