RHPN1 Antibody

  • Contact Vendor

Target HPN
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym EC 3.4.21, EC 3.4.21.106, hepsin, serine protease hepsin, serine protease hepsin catalytic chain, TMPRSS1serine protease hepsin non-catalytic chain, transmembrane protease, serine 1, Transmembrane protease serine 1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases TMPRSS1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHL