RHPN1 Antibody

  • Contact Vendor

Target RHPN1
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym GTP-Rho-binding protein 1, KIAA1929outer dense fiber of sperm tails 5, ODF5, RHPN, RHOPHILIN, rhophilin 1, rhophilin, Rho GTPase binding protein 1, rhophilin-1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases KIAA1929, ODF5, RHOPHILIN, RHPN
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RHPN1(rhophilin, Rho GTPase binding protein 1) The peptide sequence was selected from the middle region of RHPN1. Peptide sequence SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP