RHPN1 Antibody

  • Contact Vendor

Target RHPN1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym GTP-Rho-binding protein 1, KIAA1929outer dense fiber of sperm tails 5, ODF5, RHPN, RHOPHILIN, rhophilin 1, rhophilin, Rho GTPase binding protein 1, rhophilin-1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases KIAA1929, ODF5, RHOPHILIN, RHPN
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AFSLLRENFSHAPSPDMSAASLCALEQLMMAQAQECVFEGLSPPASMAPQDCLAQLRLAQEAAQVAAEYRLVHRTMAQPPVHDYVPVSWTALVHVKAE