Fc epsilon RI Antibody

  • Contact Vendor

Target Fcer1a
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym alpha polypeptide, Fc-epsilon RI-alpha, Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide, FcERI, high affinity immunoglobulin epsilon receptor alpha-subunit, high affinity immunoglobulin epsilon receptor subunit alpha, high-affinity, of mast cells, alpha polypeptide
Unit 50 ug
Format Peptide affinity purified
Concentration LYOPH mg/ml
NCBI Gene Aliases FCE1A,FcER
Company Novus Biologicals
Immunogen Synthetic peptides corresponding to FCER1A(Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide) The peptide sequence was selected from the middle region of FCER1A. Peptide sequence IYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLD
Gene Name Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide