RIBC1 Antibody

  • Contact Vendor

Target Ribc1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym FLJ32783,2610028I09Rik, MGC46233, RIB43A domain with coiled-coils 1, RIB43A-like with coiled-coils protein 1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases 2610028I09Rik, FLJ32783, MGC46233
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KERQNRFFNVRNRVMGVDVQALNNQVGDRKRREAAERSKEAAYGTSQVQYDVVVQMLEKEEADRTRQLAKKVQEFREQKQQLKNGREFSLWDPGQVWKGLPTYLSYSNTYPGPASLQYFS