RIBC1 Antibody

  • Contact Vendor

Target Ribc1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym FLJ32783,2610028I09Rik, MGC46233, RIB43A domain with coiled-coils 1, RIB43A-like with coiled-coils protein 1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases 2610028I09Rik, FLJ32783, MGC46233
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RIBC1 (RIB43A domain with coiled-coils 1) The peptide sequence was selected from the middle region of RIBC1)(50ug). Peptide sequence ANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPM