PARN Antibody

  • Contact Vendor

Target parn
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym Deadenylating nuclease, Deadenylation nuclease, DANEC 3.1.13.4, poly(A)-specific ribonuclease (deadenylation nuclease), poly(A)-specific ribonuclease PARN, Polyadenylate-specific ribonuclease
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DAN
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGA