PARN Antibody

  • Contact Vendor

Target parn
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Mus musculus, Danio rerio, Bos taurus, Homo sapiens, Xenopus laevis
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym Deadenylating nuclease, Deadenylation nuclease, DANEC 3.1.13.4, poly(A)-specific ribonuclease (deadenylation nuclease), poly(A)-specific ribonuclease PARN, Polyadenylate-specific ribonuclease
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases DAN
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the N terminal of human PARN. Peptide sequence IEEADFFAIDGEFSGISNGPSVTALTSGFDTPEERYQKLKKHSMDFLLFQ