RNase H1 Antibody

  • Contact Vendor

Target RNASEH1
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Mus musculus, Danio rerio, Bos taurus, Gallus gallus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym EC 3.1.26.4, H1RNA, Ribonuclease H type II, ribonuclease H1, RNH1, RNase H1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases H1RNA, RNH1
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the middle region of human RNASEH1. Peptide sequence EVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED