RNASEH2A Antibody

  • Contact Vendor

Species Cross Reactivity Danio rerio, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym Aicardi-Goutieres syndrome 4, Aicardi-Goutieres syndrome 4 protein, AGS4RNase H2 subunit A, JUNB, ribonuclease H2 subunit A, ribonuclease H2, large subunit, ribonuclease H2, subunit A, Ribonuclease HI large subunit, Ribonuclease HI subunit A, ribonuclease HI, large subunit, RNHIARNase HI large subunit, RNHL, RNase H(35), RNASEHIEC
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RNASEH2A (ribonuclease H2, subunit A) The peptide sequence was selected from the middle region of RNASEH2A. Peptide sequence AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE