RNASEH2B Antibody

  • Contact Vendor

Target rnaseh2b
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym ribonuclease H2, subunit B
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases AGS2, DLEU8, FLJ11712
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VVDNVFPNCILLLKLPGLEKLLHHVTEEKGNPEIDNKKYYKYSKEKTLKWLEKKVNQTVAALKTNNVNVSSRVQSTAFFSGDQASTDKEEDYIRYAH