RNase L Antibody

  • Contact Vendor

Target Rnasel
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym 2-5A-dependent ribonuclease, 2-5A-dependent RNase, 2'-5'-oligoisoadenylate synthetase-dependent, EC 3.1.26.-, HPC1, interferon-induced 2-5A-dependent RNase, MGC104972, MGC133329, PRCA1, prostate cancer 1, Ribonuclease 4, Ribonuclease L, ribonuclease L (2'-5'-oligoisoadenylate synthetase-dependent), RNS4DKFZp781D08126, RNase L
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp781D08126, MGC104972, MGC133329, PRCA1, RNS4
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HGAKEDFHPPAEDWKPQSSHWGAALKDLHRIYRPMIGKLKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSI