RNase L Antibody

  • Contact Vendor

Target Rnasel
Species Cross Reactivity Canis lupus familiaris, Sus scrofa, Bos taurus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym 2-5A-dependent ribonuclease, 2-5A-dependent RNase, 2'-5'-oligoisoadenylate synthetase-dependent, EC 3.1.26.-, HPC1, interferon-induced 2-5A-dependent RNase, MGC104972, MGC133329, PRCA1, prostate cancer 1, Ribonuclease 4, Ribonuclease L, ribonuclease L (2'-5'-oligoisoadenylate synthetase-dependent), RNS4DKFZp781D08126, RNase L
Unit 0.1 mg
Format Affinity purified
Concentration LYOPH
NCBI Gene Aliases DKFZp781D08126, MGC104972, MGC133329, PRCA1, RNS4
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the C terminal of human RNASEL. Peptide sequence MKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGA