POP4 Antibody

  • Contact Vendor

Target POP4
Species Cross Reactivity Canis lupus familiaris, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 3.1.26.5, processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae), ribonuclease P protein subunit p29, RPP29hPOP4
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases RPP29
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to POP4 (processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae)) The peptide sequence was selected from the C terminal of POP4. Peptide sequence EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAK