POP4 Antibody

  • Contact Vendor

Target POP4
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 3.1.26.5, processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae), ribonuclease P protein subunit p29, RPP29hPOP4
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases RPP29
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAI