RPP14 Antibody

  • Contact Vendor

Target RPP14
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 3.1.26.5, EC 4.2.1.-, FLJ31508, HsHTD2, P14,3-hydroxyacyl-[acyl-carrier-protein] dehydratase, ribonuclease P (14kD), ribonuclease P 14kDa subunit, ribonuclease P protein subunit p14, ribonuclease P/MRP 14kDa subunit
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ31508, P14
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAILRICSSGLVK