RPP25 Antibody

  • Contact Vendor

Target Rpp25
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym FLJ20374, ribonuclease P 25kDa subunit, ribonuclease P protein subunit p25, ribonuclease P/MRP 25kDa subunit, RNase P protein subunit p25
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ20374
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGEGSAKRSQPEP