RPP30 Antibody

  • Contact Vendor

Target RPP30
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 3.1.26.5, FLJ38491, ribonuclease P (30kD) (RPP30), ribonuclease P protein subunit p30, ribonuclease P/MRP 30kDa subunit, RNase P subunit 2, RNaseP protein p30, RNASEP2, TSG15
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ38491, TSG15
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG