RPP40 Antibody

  • Contact Vendor

Target Rpp40
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym bA428J1.3,40kD subunit, EC 3.1.26.5, ribonuclease P/MRP 40kDa subunit, RNaseP protein p40
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases RNASEP1, bA428J1.3
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQ