RNASET2 Antibody

  • Contact Vendor

Target RNASET2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 3.1.27.-, EC 3.1.27.1, FLJ10907, FLJ42372, Ribonuclease 6, ribonuclease T2, RNASE6PLbA514O12.3
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ42372, RNASE6PL, bA514O12.3
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIP