RNASET2 Antibody

  • Contact Vendor

Target RNASET2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym EC 3.1.27.-, EC 3.1.27.1, FLJ10907, FLJ42372, Ribonuclease 6, ribonuclease T2, RNASE6PLbA514O12.3
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases FLJ42372, RNASE6PL, bA514O12.3
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the middle region of human RNASET2. Peptide sequence RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI