Ribonuclease A Antibody

  • Contact Vendor

Target RNASE1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym EC 3.1.27.5, HP-RNase, MGC12408, RIB1, RIB-1, Ribonuclease 1, Ribonuclease A, ribonuclease pancreatic, ribonuclease, RNase A family, 1 (pancreatic), RNS1RNase 1, RNase A, RNase UpI-1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases MGC12408, RIB1, RNS1
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RNASE1(ribonuclease, RNase A family, 1 (pancreatic)) The peptide sequence was selected from the N terminal of RNASE1. Peptide sequence MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSS