RNASE11 Antibody

  • Contact Vendor

Target Rnase11
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym C14orf6, chromosome 14 open reading frame 6, EC 3.1.27.-, probable ribonuclease 11, ribonuclease 11, ribonuclease, RNase A family, 11 (non-active), RNase 11
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases C14orf6
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TSLSMSKDDMSSTLLTFRSLHYNDPKGNSSGNDKECCNDMTVWRKVSEANGSCKWSNNFIRSSTEVMRRVHRAPSCKFVQNPGISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWL