RNASE11 Antibody

  • Contact Vendor

Target Rnase11
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym C14orf6, chromosome 14 open reading frame 6, EC 3.1.27.-, probable ribonuclease 11, ribonuclease 11, ribonuclease, RNase A family, 11 (non-active), RNase 11
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases C14orf6
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RNASE11(ribonuclease, RNase A family, 11 (non-active)) The peptide sequence was selected from the middle region of RNASE11. Peptide sequence GISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWL