RNASE7 Antibody

  • Contact Vendor

Target RNASE7
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 3.1.27, EC 3.1.27.-, EC 3.1.27.5, MGC133220, ribonuclease 7, ribonuclease, RNase A family, 7, RNase 7, SAP-2, Skin-derived antimicrobial protein 2
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MGC133220
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRV