RNASE9 Antibody

  • Contact Vendor

Target RNASE9
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym h461, HEL128, ribonuclear enzyme, ribonuclease 9, ribonuclease, RNase A family, 9 (non-active), ribonuclease-like protein 9
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases HEL128, h461
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNHEIMGKNVYYKHRWVAEHYFLLMQYDELQKICYNRFVPCKNGIRKCNRSKGLVEGVYCNLT