RNASE6 Antibody

  • Contact Vendor

Target RNASE6
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 3.1.27, EC 3.1.27.-, EC 3.1.27.5, ribonuclease K6, ribonuclease, RNase A family, k6, RNS6, RNase K6, RNasek6
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases RNS6, RNasek6
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PKRITKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPV