RNASEK Antibody

  • Contact Vendor

Target Rnasek
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 3.1, MGC48891, MGC71993, ribonuclease kappa, ribonuclease, RNase K, RNase K, RNase kappa
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MGC48891, MGC71993
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SAVLIEDVPFTEKDFENGPQNIYNLYEQVS