RAVER2 Antibody

  • Contact Vendor

Target RAVER2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym DKFZp762D1011, KIAA1579FLJ10770, Protein raver-2, ribonucleoprotein PTB-binding 2, ribonucleoprotein, PTB-binding 2
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp762D1011, FLJ10770, KIAA1579
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SPASKTTLHKTGIASSILDAISQGSESQHALEKCIAYSPPFGDYAQVSSLRNEKRGSSYLISAPEGGSVECVDQHSQGTG