RRM2 Antibody

  • Contact Vendor

Target Rrm2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym EC 1.17.4.1, R2, ribonucleotide reductase M2, ribonucleotide reductase M2 polypeptide, Ribonucleotide reductase small chain, Ribonucleotide reductase small subunit, ribonucleoside-diphosphate reductase subunit M2, RR2, RR2M
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases R2, RR2, RR2M
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RRM2(ribonucleotide reductase M2 polypeptide) The peptide sequence was selected from the N terminal of RRM2. Peptide sequence PALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP