p53R2 Antibody

  • Contact Vendor

Target RRM2B
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym EC 1.17.4.1, MGC102856, MGC42116, MTDPS8A, MTDPS8B, p53-inducible ribonucleotide reductase small subunit 2 homolog, p53-inducible ribonucleotide reductase small subunit 2-like protein, p53R2, P53R2DKFZp686M05248, PEOA5, ribonucleotide reductase M2 B (TP53 inducible), ribonucleoside-diphosphate reductase subunit M2 B, TP53-inducible ribonucleotide reductase M2 B
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp686M05248, MGC102856, MGC42116, MTDPS8A, MTDPS8B, P53R2
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFV