Ribophorin I Antibody

  • Contact Vendor

Target RPN1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym DKFZp686B16177, dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit, dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1, EC 2.4.1.119, oligosaccharyltransferase 1 homolog, OST1, ribophorin IRBPH1, Ribophorin-1, ribophorin-1, RPN-I
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases DKFZp686B16177, OST1, RBPH1
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPN1(ribophorin I) The peptide sequence was selected from the N terminal of RPN1. Peptide sequence TSRATSFLLALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRF