RPIA Antibody

  • Contact Vendor

Target rpiA
Species Cross Reactivity Sus scrofa, Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym EC 5.3.1.6, phosphoriboisomerase, Phosphoriboisomerase, ribose 5-phosphate epimerase, ribose 5-phosphate isomerase A, RPIribose-5-phosphate isomerase
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases RPI
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPIA(ribose 5-phosphate isomerase A (ribose 5-phosphate epimerase)) The peptide sequence was selected from the N terminal of RPIA. Peptide sequence MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG