RPIA Antibody

  • Contact Vendor

Target rpiA
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 5.3.1.6, phosphoriboisomerase, Phosphoriboisomerase, ribose 5-phosphate epimerase, ribose 5-phosphate isomerase A, RPIribose-5-phosphate isomerase
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases RPI
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AVENHVRNNQVLGIGSGSTIVHAVQRIAERVKQENLNLVCIPTSFQARQLILQYGLTLSDLDRHPEIDLAID