RPL24/RLP24 Antibody

  • Contact Vendor

Target Rsl24d1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym C15orf15, HRP-L30-iso, L30, RLP24, RPL24, RPL24L, RSL24D1 ribosomal L24 domain containing 1, TVAS3
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases C15orf15, HRP-L30-iso, L30, RLP24, RPL24, RPL24L, TVAS3
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to C15ORF15 The peptide sequence was selected from the middle region of C15ORF15. Peptide sequence FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQED