MRPL10 Antibody

  • Contact Vendor

Target mRpL10
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym L10mt, MGC17973, mitochondrial ribosomal protein L10, MRP-L839S ribosomal protein L10, mitochondrial, MRPL839S ribosomal protein L8, mitochondrial, MRP-L10L8mt, RPML8L10MT
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases L10MT, MGC17973, MRP-L10, MRP-L8, MRPL8, RPML8
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NVALSAEDKLLMRHQLRKHKILMKVFPNQVLKPFLEDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLGGC