RPL10 Antibody

  • Contact Vendor

Target RPL10
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym 60S ribosomal protein L10, DXS648EFLJ27072, DXS648FLJ23544, Laminin receptor homolog, NOV, Protein QM, QMDKFZp686J1851, ribosomal protein L10, Tumor suppressor QM, Wilms tumor-related protein
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp686J1851, DXS648, DXS648E, FLJ23544, FLJ27072, L10, NOV, QM
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KMSSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPSRGPLDKWW