RPL10A Antibody

  • Contact Vendor

Target rpl10a
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym CSA-19, Csa-19,60S ribosomal protein L10a, Neural precursor cell expressed developmentally down-regulated protein 6, NEDD6, NEDD-6, ribosomal protein L10a
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases Csa-19, L10A, NEDD6
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPL10A (ribosomal protein L10a) The peptide sequence was selected from the N terminal of RPL10A)(50ug). Peptide sequence MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFS