RPL11 Antibody

  • Contact Vendor

Target rpl11
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym cell growth-inhibiting protein 34,60S ribosomal protein L11, CLL-associated antigen KW-12, DBA7, GIG34, ribosomal protein L11
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DBA7, GIG34, L11
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEE