MRPL13 Antibody

  • Contact Vendor

Target MRPL13
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym 39S ribosomal protein L13, mitochondrial, L13, L13A, L13mtRPML13, mitochondrial ribosomal protein L13, MRP-L13, RPL13
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases L13, L13A, L13mt, RPL13, RPML13
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to MRPL13(mitochondrial ribosomal protein L13) The peptide sequence was selected from the middle region of MRPL13. Peptide sequence AIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLD