RPL13A Antibody

  • Contact Vendor

Target RpL13A
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym 60S ribosomal protein L13a, ribosomal protein L13a, tissue specific transplantation antigen 1,23 kDa highly basic protein, TSTA1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases L13A, TSTA1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNV