RPL13A Antibody

  • Contact Vendor

Target RpL13A
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym 60S ribosomal protein L13a, ribosomal protein L13a, tissue specific transplantation antigen 1,23 kDa highly basic protein, TSTA1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases L13A, TSTA1
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPL13A(ribosomal protein L13a) The peptide sequence was selected from the middle region of RPL13A. Peptide sequence HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY