MRPL2 Antibody

  • Contact Vendor

Target MRPL2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym CGI-22, L2mt, mitochondrial ribosomal protein L2, MRP-L14, MRP-L2, RPML14,39S ribosomal protein L2, mitochondrial
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MRP-L14, RPML14
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PAPSLFPAAQMMNNGLLQQPSALMLLPCRPVLTSVALNANFVSWKSRTKYTITPVKMRKSGGRDHTGRIRVHGIGGGHKQRYRMIDFLRFRPEETKSGPFEEKVIQVRYDP