MRPL15 Antibody

  • Contact Vendor

Target MRPL15
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym L15mtHSPC145, mitochondrial ribosomal protein L15, MRP-L7, MRP-L1539S ribosomal protein L15, mitochondrial, RPML7
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases L15mt, MRP-L15, MRP-L7, RPML7
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to MRPL15(mitochondrial ribosomal protein L15) The peptide sequence was selected from the N terminal of MRPL15. Peptide sequence KPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKYGFN