MRPL15 Antibody

  • Contact Vendor

Target MRPL15
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym L15mtHSPC145, mitochondrial ribosomal protein L15, MRP-L7, MRP-L1539S ribosomal protein L15, mitochondrial, RPML7
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases L15mt, MRP-L15, MRP-L7, RPML7
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LRGQPIPKRMLPPEELVPYYTDAKNRGYLADPAKFPEARLELARKYGYILPDITKDELFKMLCTRKDPRQIFFGLAPGWVVNMADKKILKPTDEN