RPL15 Antibody

  • Contact Vendor

Target RPL15
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym 60S ribosomal protein L15, EC45MGC88603, FLJ26304, ribosomal protein L15, RPYL10, RPL10, RPLY10
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases EC45, FLJ26304, L15, MGC88603, RPL10, RPLY10, RPYL10
Cite This Product Novus Biologicals cat# NBP1-84018 RRID:AB_11035927
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGLGKGHKFHHTIGGSR