Ribosomal Protein L17 Antibody

  • Contact Vendor

Target RPL17
Species Cross Reactivity Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym FLJ18762,60S ribosomal protein L23, FLJ92089, gene encoding putative NFkB activating protein, MGC117162, PD-1, ribosomal protein L17, rpL23, RPL23,60S ribosomal protein L17
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases FLJ18762, FLJ92089, L17, MGC117162, PD-1, RPL23
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to the N terminal of Rpl17. Immunizing peptide sequence SLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLK