MRPL18 Antibody

  • Contact Vendor

Target MRPL18
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym HSPC071,39S ribosomal protein L18, mitochondrial, L18mt, mitochondrial ribosomal protein L18, MRP-L18
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases L18mt, MRP-L18
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NGKVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAGINFMVYQPTPWEAASDSMKRLQS